PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000242596
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 1233aa    MW: 136242 Da    PI: 9.5243
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000242596genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.51.2e-32242298259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    dD ynWrKYGqK+vkgsefprsYY+Ct+ +Cpvkkkvers  +++++ei+Y+g+Hnhe
  MDP0000242596 242 DDXYNWRKYGQKQVKGSEFPRSYYKCTHMNCPVKKKVERSP-NGEITEIIYKGQHNHE 298
                    8****************************************.***************8 PP

2WRKY100.51e-31414472159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++pr YY+Ct+agC+v+k+ver+++d k+v++tYeg+Hnh+
  MDP0000242596 414 LDDGYRWRKYGQKVVKGNPHPRCYYKCTFAGCNVRKHVERASTDAKAVITTYEGKHNHD 472
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.8E-28231300IPR003657WRKY domain
PROSITE profilePS5081123.812236300IPR003657WRKY domain
SuperFamilySSF1182902.62E-25238300IPR003657WRKY domain
SMARTSM007743.0E-36241299IPR003657WRKY domain
PfamPF031069.2E-25242298IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-35399474IPR003657WRKY domain
SuperFamilySSF1182903.66E-28406474IPR003657WRKY domain
PROSITE profilePS5081137.665409474IPR003657WRKY domain
SMARTSM007742.5E-38414473IPR003657WRKY domain
PfamPF031061.7E-24415472IPR003657WRKY domain
SuperFamilySSF561121.23E-89669966IPR011009Protein kinase-like domain
Gene3DG3DSA:3.30.200.202.1E-32673774No hitNo description
PfamPF000694.5E-68676960IPR000719Protein kinase domain
SMARTSM002209.7E-92676960IPR000719Protein kinase domain
CDDcd078406.06E-147676960No hitNo description
PROSITE profilePS5001144.852676960IPR000719Protein kinase domain
PROSITE patternPS001070682705IPR017441Protein kinase, ATP binding site
Gene3DG3DSA:1.10.510.101.2E-527751009No hitNo description
PROSITE patternPS001080796808IPR008271Serine/threonine-protein kinase, active site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006468Biological Processprotein phosphorylation
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004672Molecular Functionprotein kinase activity
GO:0005524Molecular FunctionATP binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1233 aa     Download sequence    Send to blast
MAAKTQDSDR VTVSAPPLLP TQRPVITLPP RPSAEAFFSG GSGASPGPMT LVSNFFDTYP  60
ESDFRSFSQL LAGAMGSPVG STRGMSXFTE NPADGLRKXG GGSESGEGSS GFKQSRPMSL  120
AVARPPLFTV PPGLSPSGLL NSPGFYSPQS PFGMSHQQAL AQVTAQAALA QSRVYMQPEY  180
QPSSVAPPTE PEERQLSLMP NEASQQQTLP STSNTKSSAR QSPEASHSDK KYQPSSTDRP  240
ADDXYNWRKY GQKQVKGSEF PRSYYKCTHM NCPVKKKVER SPNGEITEII YKGQHNHEVP  300
QPSKRPKDGD LNGPKPENGL QRRIGDSNRS SENVASYSRX EMDQESTQAA PGQLPGENDN  360
EELGDGESRE EGDADEPNAK RRNIDVGASE VALPHKTVTE PKIIVQTRSE VDLLDDGYRW  420
RKYGQKVVKG NPHPRCYYKC TFAGCNVRKH VERASTDAKA VITTYEGKHN HDVPAARNSS  480
HNTANNSASQ LKPPASGASQ HTLLKGREYG NNDQRPRAAA TASPCYEYSA AVSHNGSVLL  540
QPSSSSLKKD NSASAATTNN NVSRSKSKAK SKSNSSEFKK SGSKKDPQNH RPGDVSEDRS  600
VVXGRESKKS RKEKEGSYHS HNSHNGGKGS AFSFRLGFSS RSSLEAEQVS AGWPSWLSAA  660
AGEVIYGWIP LKADAYEKLE KIGQGTYSSV FRAKEVETGR IVALKKVRFD NFQPESIRFM  720
AREIMILRRL DHPNIMKLEG IITSRSSNSI YLVFEYMEHD LAGLVASPEI KFSDMQIKCY  780
XRQLLSAVEH CHLRGIMHRD IKASNILVND DGILKLGDFG LANVVNSKSK QPLTSRVVTL  840
WYRPPELLMG ATEYGVSVDL WSVGCVFAEL FLGKPILKGR TEVEQLHKIF KLCGSPPEEY  900
WKTSKLPHAT MFKPQHTYES SLRERCKEFP TTAVDMLENL LSVEPYKRGT VSSALMSEYF  960
KTKPYACDPS HLPKYPPTKE MDAKIREESQ RKKPGIRARE TRKPRRVRKA LLESNSSAKL  1020
APKEVFLYXY SCSPARVADG QDDHTQSARR MNGGNPLILR AKGGLLRRES NLKPQFDTVS  1080
ENCELNASLG DSTLSSVQTS AASGFAWAKR GTEDGTQSAV SDGSKSQFSA LDANFARSTY  1140
DLKQGHRTGR MAIRKLRTFD ASELTSTEEP DDAGNNTDYI AEEKRDIEFS GPLLSQPXRI  1200
DEHLRRNESH IRHVARRSRF EKEVEPESLQ VAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4nst_A9e-81673100012347Cyclin-dependent kinase 12
4nst_C9e-81673100012347Cyclin-dependent kinase 12
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.126970.0fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP0529390.0KP052939.1 Pyrus pyrifolia WRKY transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008348081.10.0PREDICTED: probable serine/threonine-protein kinase At1g54610
TrEMBLM5WYB00.0M5WYB0_PRUPE; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-111WRKY DNA-binding protein 3